The KH domain within your query sequence starts at position 593 and ends at position 663, and its E-value is 1.59e-10.

DLIIWEIEVPKHLVGRLIGKQGRYVSFLKQTSGAKIYISTLPYTQNIQICHIEGSQHHVDKALNLIGKKFK
KH

KH

K homology RNA-binding domain
SMART ACC:SM000322
Description: -
InterPro ACC:IPR004087
InterPro abstract:

The K homology (KH) domain was first identified in the human heterogeneous nuclear ribonucleoprotein (hnRNP) K. An evolutionarily conserved sequence of around 70 amino acids, the KH domain is present in a wide variety of nucleic acid-binding proteins. The KH domain binds RNA, and can function in RNA recognition [ PUBMED:17437720 expand

GO function:nucleic acid binding (GO:0003676)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 181 505 KH domains in 115 166 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing KH domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing KH domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:RNA-binding

Relevant references for this domain

Primary literature for the KH domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the KH domain.

ProteinDescriptionDisease / phenotype
FMR1_HUMANOMIM:309550 : Fragile X syndrome

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a KH domain which could be assigned to a KEGG orthologous group, and not all proteins containing KH domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR004087
PfamKH-domain