The DBP10CT domain within your query sequence starts at position 706 and ends at position 766, and its E-value is 1.45e-25.

DLMGDEAQNMSRGQQQLKWDRKKKRFVGQSGQEDKKKIKTESGRFISSSYKRDLYQKWKQK
DBP10CT

DBP10CT

DBP10CT (NUC160) domain
SMART ACC:SM001123
Description:This C terminal domain is found in the Dbp10p subfamily of hypothetical RNA helicases ((PUBMED:15112237)).
InterPro ACC:IPR012541
InterPro abstract:

This group of DEAD-box RNA helicases includes Dbp10 from fungi, DDX54 (also known as DP97) from mammals and RH29 from plants. DDX54 interacts in a hormone-dependent manner with nuclear receptors [ PUBMED:12466272 PUBMED:22910411 ]. It plays … expand

GO component:nucleus (GO:0005634)
GO function:RNA binding (GO:0003723), RNA helicase activity (GO:0003724), ATP binding (GO:0005524)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 552 DBP10CT domains in 1 552 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DBP10CT domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DBP10CT domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Translation

Relevant references for this domain

Primary literature for the DBP10CT domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DBP10CT domain which could be assigned to a KEGG orthologous group, and not all proteins containing DBP10CT domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamDBP10CT
InterProIPR012541