The FBG domain within your query sequence starts at position 241 and ends at position 454, and its E-value is 1.5e-58.

DLPADCSAVYNRGEHTSGVYTIKPRNSQGFNVYCDTQSGSPWTLIQHRKDGSQDFNETWENYEKGFGRLDGEFWLGLEKIYAIVQQSNYILRLELQDWKDSKHYVEYSFHLGSHETNYTLHVAEIAGNIPGALPEHTDLMFSTWNHRAKGQLYCPESYSGGWWWNDICGENNLNGKYNKPRTKSRPERRRGIYWRPQSRKLYAIKSSKMMLQPT
FBG

FBG

Fibrinogen-related domains (FReDs)
SMART ACC:SM000186
Description:Domain present at the C-termini of fibrinogen beta and gamma chains, and a variety of fibrinogen-related proteins, including tenascin and Drosophila scabrous.
InterPro ACC:IPR002181
InterPro abstract:

This entry represents the C-terminal globular D domain of the alpha, beta and gamma chains. These domains are related to domains in other proteins: in the Parastichopus parvimensis (Sea cucumber) fibrogen-like FreP-A and FreP-B proteins; in the C terminus of the Drosophila scabrous protein that is involved in the regulation of neurogenesis, possibly through the inhibition of R8 cell differentiation; … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 19 827 FBG domains in 19 491 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing FBG domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing FBG domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the FBG domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the FBG domain.

ProteinDescriptionDisease / phenotype
FIBB_HUMANOMIM:134830 : Dysfibrinogenemia, beta type ; Afibrinogenemia, congenital
OMIM:202400 : Thrombophilia, dysfibrinogenemic
FIBG_HUMANOMIM:134850 : Dysfibrinogenemia, gamma type ; Hypofibrinogenemia, gamma type ; Thrombophilia, dysfibrinogenemic

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a FBG domain which could be assigned to a KEGG orthologous group, and not all proteins containing FBG domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfamfibrinogen_C
InterProIPR002181
PROSITEFBG_DOMAIN