The eIF3_N domain within your query sequence starts at position 5 and ends at position 138, and its E-value is 4.88e-70.

DLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADKHGFRQEYLDTLYRYAKFQ
eIF3_N

eIF3_N

eIF3 subunit 6 N terminal domain
SMART ACC:SM001186
Description:This is the N terminal domain of subunit 6 translation initiation factor eIF3.
InterPro ACC:IPR019010
InterPro abstract:

This entry represents the N-terminal domain of the eukaryotic translation initiation factor 3 subunit E. EIF3 is required in protein synthesis in mammalian cells and, together with other initiation factors, stimulates binding of initiator methionyl-tRNAi and mRNA to the 40S ribosomal subunit to form the 48 S initiation complex [ PUBMED:17322308 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 464 eIF3_N domains in 1 464 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing eIF3_N domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing eIF3_N domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Translation

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a eIF3_N domain which could be assigned to a KEGG orthologous group, and not all proteins containing eIF3_N domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfameIF3_N
InterProIPR019010