The STI1 domain within your query sequence starts at position 492 and ends at position 531, and its E-value is 1.66e-9.

DPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKI
STI1

STI1

Heat shock chaperonin-binding motif.
SMART ACC:SM000727
Description: -
InterPro ACC:IPR006636
InterPro abstract:

This entry represents a heat shock chaperonin-binding domain found in human Stress-inducible phosphoprotein STI1 and similar sequences found in eukaryotes. STI1 acts as a co-chaperone for HSP90AA1 [ PUBMED:27353360 ]. Both N- and C-terminal ends of STI1 are capable of binding heat shock proteins [ PUBMED:8999875 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 15 629 STI1 domains in 8 650 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing STI1 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing STI1 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling
Binding / catalysis:Heat shock chaperonin-binding

Relevant references for this domain

Primary literature for the STI1 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a STI1 domain which could be assigned to a KEGG orthologous group, and not all proteins containing STI1 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006636