The FCH domain within your query sequence starts at position 150 and ends at position 236, and its E-value is 6.62e-25.

DPQGNGTVAGFELLLQKQLKGKQMQKEMSEFIRERIKIEEEYAKNLAKLSQNSLAAQEEGSLGEAWAQVKKSLADEAEVHLKFSAKL
FCH

FCH

Fes/CIP4 homology domain
SMART ACC:SM000055
Description:Alignment extended from original report. Highly alpha-helical. Also known as the RAEYL motif or the S. pombe Cdc15 N-terminal domain.
InterPro ACC:IPR001060
InterPro abstract:

FCH domain is a short conserved region of around 60 amino acids first described as a region of homology between FER and CIP4 proteins [ PUBMED:9210375 ]. In the CIP4 protein the FCH domain binds to microtubules [ PUBMED:10713100 ]. The FCH domain … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 9 693 FCH domains in 9 691 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing FCH domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing FCH domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Unknown

Relevant references for this domain

Primary literature for the FCH domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a FCH domain which could be assigned to a KEGG orthologous group, and not all proteins containing FCH domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001060