The HECTc domain within your query sequence starts at position and ends at position , and its E-value is < 1e-12.

Some of the required catalytic sites were not detected in this domain, and are marked red in the sequence below. The domain is probably inactive. Check the literature (PubMed 22423789 ) for details.

Catalytic residues
Position
DomainProteinAmino acidPresent?
N/AN/ACNo
DQNVPQYKRDFRRKVIYFRSQPALRILPGQCHIKVRRKNIFEDAYQEIM
HECTc

HECTc

Domain Homologous to E6-AP Carboxyl Terminus with
SMART ACC:SM000119
Description:E3 ubiquitin-protein ligases. Can bind to E2 enzymes.
InterPro ACC:IPR000569
InterPro abstract:

The HECT (Homologous to the E6-AP Carboxyl Terminus) domain is an around 350 amino acids motif that has been identified in proteins that all belong to a particular E3 ubiquitin-protein ligase family [ PUBMED:7708685 ]. HECT domain containing proteins accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form … expand

GO function:ubiquitin-protein transferase activity (GO:0004842)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 23 694 HECTc domains in 23 671 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing HECTc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing HECTc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Ubiquitin-protein ligase

Relevant references for this domain

Primary literature for the HECTc domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a HECTc domain which could be assigned to a KEGG orthologous group, and not all proteins containing HECTc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000569