The SynN domain within your query sequence starts at position 24 and ends at position 145, and its E-value is 1.99e-44.

DRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAILAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMTEYNATQSKYRDRCK
SynN

SynN

Syntaxin N-terminal domain
SMART ACC:SM000503
Description:Three-helix domain that (in Sso1p) slows the rate of its reaction with the SNAP-25 homologue Sec9p
InterPro ACC:IPR006011
InterPro abstract:

Syntaxins are the prototype family of SNARE proteins. They usually consist of three main regions - a C-terminal transmembrane region, a central SNARE domain which is characteristic of and conserved in all syntaxins IPR000727 and an N-terminal domain that is featured in this entry. This domain varies between … expand

GO component:membrane (GO:0016020)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 5 994 SynN domains in 5 987 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing SynN domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing SynN domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the SynN domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a SynN domain which could be assigned to a KEGG orthologous group, and not all proteins containing SynN domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006011