The LAMTOR domain within your query sequence starts at position 15 and ends at position 90, and its E-value is 1.48e-22.

DREERKLLLDPSSTPTKALNGAEPNYHSLPSARTDEQALLSSILAKTASNIIDVSAADSQGMEQHEYMDRARQYST
LAMTOR

LAMTOR

Late endosomal/lysosomal adaptor and MAPK and MTOR activator
SMART ACC:SM001262
Description:LAMTOR is a family of eukaryotic proteins that have otherwise been referred to as Lipid raft adaptor protein p18, Late endosomal/lysosomal adaptor and MAPK and MTOR activator 1, and Protein associated with DRMs and endosomes. It is found to be one of three small proteins constituting the Rag complex or Ragulator that interact with each other, localise to endosomes and lysosomes, and play positive roles in the MAPK pathway. The complex does this by interacting with the Rag GTPases, recruiting them to lysosomes, and bringing about mTORC1 activation.
InterPro ACC:IPR028209
InterPro abstract:

LAMTOR1 is a family of eukaryotic proteins that have otherwise been referred to as Lipid raft adaptor protein p18, Late endosomal/lysosomal adaptor and MAPK and MTOR activator 1, and Protein associated with DRMs and endosomes.

LAMTOR1 regulates the mTOR (mammalian target of rapamycin) pathway, a signaling cascade that promotes cell growth in response to growth factors, energy levels … expand

GO process:cellular response to amino acid stimulus (GO:0071230), regulation of receptor recycling (GO:0001919), cholesterol homeostasis (GO:0042632), positive regulation of MAPK cascade (GO:0043410), lysosome organization (GO:0007040), positive regulation of TOR signaling (GO:0032008), endosomal transport (GO:0016197)
GO component:late endosome membrane (GO:0031902), Ragulator complex (GO:0071986), membrane raft (GO:0045121)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 801 LAMTOR domains in 799 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing LAMTOR domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing LAMTOR domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the LAMTOR domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a LAMTOR domain which could be assigned to a KEGG orthologous group, and not all proteins containing LAMTOR domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamLAMTOR
InterProIPR028209