The TFS2M domain within your query sequence starts at position 184 and ends at position 285, and its E-value is 1.05e-52.

DSVRDKCVEMLSAALKAEDNFKDYGVNCDKLASEIEDHIYQELKSTDMKYRNRVRSRISNLKDPRNPGLRRNVLSGAISPELIAKMTAEEMASDELRELRNA
TFS2M

TFS2M

Domain in the central regions of transcription elongation factor S-II (and elsewhere)
SMART ACC:SM000510
Description: -
InterPro ACC:IPR003618
InterPro abstract:

This domain is found in the central region of transcription elongation factor S-II and in several hypothetical proteins.

Transcription factor S-II (TFIIS) induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites. It is widely distributed being found in mammals, Drosophila, yeast and in the archaebacteria Sulfolobus … expand

GO process:DNA-templated transcription (GO:0006351)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 186 TFS2M domains in 2 182 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing TFS2M domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing TFS2M domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a TFS2M domain which could be assigned to a KEGG orthologous group, and not all proteins containing TFS2M domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003618