The Fe_hyd_SSU domain within your query sequence starts at position 410 and ends at position 466, and its E-value is 9.56e-17.

DTEGSELLQQLERLYSMVRTEAPEDAPGVQELYQHWLQGEDSERASRLLHTQYHAVE
Fe_hyd_SSU

Fe_hyd_SSU

Iron hydrogenase small subunit
SMART ACC:SM000902
Description:Many microorganisms, such as methanogenic, acetogenic, nitrogen-fixing, photosynthetic, or sulphate-reducing bacteria, metabolise hydrogen. Hydrogen activation is mediated by a family of enzymes, termed hydrogenases, which either provide these organisms with reducing power from hydrogen oxidation, or act as electron sinks. There are two hydrogenases families that differ functionally from each other: NiFe hydrogenases tend to be more involved in hydrogen oxidation, while Iron-only FeFe (Fe only) hydrogenases in hydrogen production. Fe only hydrogenases show a common core structure, which contains a moiety, deeply buried inside the protein, with an Fe-Fe dinuclear centre, nonproteic bridging, terminal CO and CN- ligands attached to each of the iron atoms, and a dithio moiety, which also bridges the two iron atoms and has been tentatively assigned as a di(thiomethyl)amine. This common core also harbours three [4Fe-4S] iron-sulphur clusters (PUBMED:11921392). In FeFe hydrogenases, as in NiFe hydrogenases, the set of iron-sulphur clusters is dispersed regularly between the dinuclear Fe-Fe centre and the molecular surface. These clusters are distant by about 1.2 nm from each other but the [4Fe-4S] cluster closest to the dinuclear centre is covalently bound to one of the iron atoms though a thiolate bridging ligand. The moiety including the dinuclear centre, the thiolate bridging ligand, and the proximal [4Fe-4S] cluster is known as the H-cluster. A channel, lined with hydrophobic amino acid side chains, nearly connects the dinuclear centre and the molecular surface. Furthermore hydrogen-bonded water molecule sites have been identified at the interior and at the surface of the protein. The small subunit is comprised of alternating random coil and alpha helical structures that encompass the large subunit in a novel protein fold (PUBMED:10368269).
InterPro ACC:IPR003149
InterPro abstract:

This family represents the small subunit of the Fe-only hydrogenases ( EC:1.18.99.1 ). The subunit is comprised of alternating random coil and α-helical structures that encompasses the large subunit in a novel protein fold [ PUBMED:10368269 ].

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 4 428 Fe_hyd_SSU domains in 4 426 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Fe_hyd_SSU domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Fe_hyd_SSU domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

Relevant references for this domain

Primary literature for the Fe_hyd_SSU domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Fe_hyd_SSU domain which could be assigned to a KEGG orthologous group, and not all proteins containing Fe_hyd_SSU domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003149
PfamFe_hyd_SSU