The PDZ domain within your query sequence starts at position 213 and ends at position 295, and its E-value is 3.82e-20.

DTLGFNIIGGRPYQNSQKQSAPEGIYVSKILENGPADRADGLEVHDKIIAVNGRDLSKATHEEAVEAFRTAKEPIVVQVLRRT
PDZ

PDZ

Domain present in PSD-95, Dlg, and ZO-1/2.
SMART ACC:SM000228
Description:Also called DHR (Dlg homologous region) or GLGF (relatively well conserved tetrapeptide in these domains). Some PDZs have been shown to bind C-terminal polypeptides; others appear to bind internal (non-C-terminal) polypeptides. Different PDZs possess different binding specificities.
InterPro ACC:IPR001478
InterPro abstract:

PDZ domains (also known as Discs-large homologous regions (DHR) or GLGF)) are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [ PUBMED:9041651 PUBMED:9204764 ]. PDZ domains can occur in one or multiple … expand

GO function:protein binding (GO:0005515)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 333 040 PDZ domains in 224 949 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PDZ domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PDZ domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling
Binding / catalysis:Protein-binding, C-terminal peptide-bindin

Relevant references for this domain

Primary literature for the PDZ domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PDZ domain which could be assigned to a KEGG orthologous group, and not all proteins containing PDZ domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001478
PfamPF00595