The L27 domain within your query sequence starts at position 7 and ends at position 67, and its E-value is 7.33e-12.

DTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCV
L27

L27

domain in receptor targeting proteins Lin-2 and Lin-7
SMART ACC:SM000569
Description: -
InterPro ACC:IPR004172
InterPro abstract:

The L27 domain is a ~50-amino acid module, initially identified in the Lin-2 and Lin-7 proteins, that exists in a large family of animal scaffold proteins [ PUBMED:10871881 ]. The L27 domain is a specific protein-protein interaction module capable of forming heteromeric complexes that can integrate multiple scaffold … expand

GO function:protein binding (GO:0005515)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 11 302 L27 domains in 7 766 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing L27 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing L27 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling

Relevant references for this domain

Primary literature for the L27 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a L27 domain which could be assigned to a KEGG orthologous group, and not all proteins containing L27 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR004172