The DKCLD domain within your query sequence starts at position 47 and ends at position 105, and its E-value is 1.85e-32.

DTSQWPLLLKNFDKLNVRTAHYTPLPCGSNPLKREIGDYIRTGFINLDKPSNPSSHEVV
DKCLD

DKCLD

DKCLD (NUC011) domain
SMART ACC:SM001136
Description:This is a TruB_N/PUA domain associated N-terminal domain of Dyskerin-like proteins ((PUBMED:15112237)).
InterPro ACC:IPR012960
InterPro abstract:

This is an N-terminal domain of dyskerin-like proteins, which is often associated with the TruB N-terminal ( IPR002501 ) and PUA ( IPR002478 ) domains [ PUBMED:15112237 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 290 DKCLD domains in 3 289 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DKCLD domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DKCLD domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the DKCLD domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DKCLD domain which could be assigned to a KEGG orthologous group, and not all proteins containing DKCLD domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamDKCLD
InterProIPR012960