The DCX domain within your query sequence starts at position 11 and ends at position 98, and its E-value is 2.16e-29.

DTTPAKTILVYRNGDQFYVGRKFVFSRRRVANFEALLEQLTEQVEVPFGVRRLYTPTRGHPVLGLDALQTGGKYVAAGRERFKKLDYI
DCX

DCX

Domain in the Doublecortin (DCX) gene product
SMART ACC:SM000537
Description:Tandemly-repeated domain in doublin, the Doublecortin gene product. Proposed to bind tubulin. Doublecortin (DCX) is mutated in human X-linked neuronal migration defects.
InterPro ACC:IPR003533
InterPro abstract:

X-linked lissencephaly is a severe brain malformation affecting males. Recently it has been demonstrated that the doublecortin gene is implicated in this disorder [ PUBMED:9489699 ]. Doublecortin was found to bind to the microtubule cytoskeleton. In vivo and in vitro assays show that Doublecortin stabilises microtubules … expand

GO process:intracellular signal transduction (GO:0035556)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 5 674 DCX domains in 2 887 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DCX domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DCX domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the DCX domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the DCX domain.

ProteinDescriptionDisease / phenotype
DCX_HUMANOMIM:300067 : Lissencephaly, X-linked
OMIM:300121 : Lissencephaly, X-linked
OMIM:300067 : Subcortical laminal heteropia, X-linked
OMIM:300067 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DCX domain which could be assigned to a KEGG orthologous group, and not all proteins containing DCX domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003533