The KU domain within your query sequence starts at position 75 and ends at position 128, and its E-value is 1.49e-22.

DVCSLPQDPGPCLAYLPRWWYNQETDLCTEFIYGGCQGNPNNFPSEGICTVVCK
KU

KU

BPTI/Kunitz family of serine protease inhibitors.
SMART ACC:SM000131
Description:Serine protease inhibitors. One member of the family is encoded by an alternatively-spliced form of Alzheimer's amyloid beta-protein.
InterPro ACC:IPR002223
InterPro abstract:

The majority of the sequences having this domain belong to the MEROPS inhibitor family I2, clan IB; the Kunitz/bovine pancreatic trypsin inhibitor family, they inhibit proteases of the S1 family [ PUBMED:14705960 ] and are restricted to the metazoa with a single exception: Amsacta moorei entomopoxvirus. They are short … expand

GO function:serine-type endopeptidase inhibitor activity (GO:0004867)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 33 749 KU domains in 16 023 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing KU domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing KU domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the KU domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a KU domain which could be assigned to a KEGG orthologous group, and not all proteins containing KU domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR002223
PROSITEKU_DOMAIN
PfamKunitz_BPTI