The YccV-like domain within your query sequence starts at position 500 and ends at position 597, and its E-value is 8.22e-39.

DVCYSIGLVMKHKRYGYNCVIYGWDPTCMMGHEWIRNMNVHSLPHGHHQPFYNVLVEDGSCRYAAQENLEYNVEPQEISHPDVGRYFSEFTGTHYIPN
YccV-like

YccV-like

Hemimethylated DNA-binding protein YccV like
SMART ACC:SM000992
Description:YccV is a hemimethylated DNA binding protein which has been shown to regulate dnaA gene expression. The structure of one of the hypothetical proteins in this family has been solved and it forms a beta sheet structure with a terminating alpha helix.
InterPro ACC:IPR011722
InterPro abstract:

Heat shock protein HspQ, also known as YccV, is an Escherichia coli hemimethylated DNA binding protein which has been shown to regulate dnaA gene expression [ PUBMED:12700277 PUBMED:28575662 ].

This entry represents a YccV-like hemimethylated … expand

GO function:DNA binding (GO:0003677)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 4 240 YccV-like domains in 4 235 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing YccV-like domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing YccV-like domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transport

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a YccV-like domain which could be assigned to a KEGG orthologous group, and not all proteins containing YccV-like domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamYccV-like
InterProIPR011722