The EGF_CA domain within your query sequence starts at position 795 and ends at position 836, and its E-value is 3.61e-12.

DVDECSRSPSPCAYGRCENTEGSFKCVCPTGFQPNAAGSECE
EGF_CA

EGF_CA

Calcium-binding EGF-like domain
SMART ACC:SM000179
Description: -
InterPro ACC:IPR001881
InterPro abstract:

A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [ PUBMED:2288911 PUBMED:6334307 PUBMED:3534958 expand

GO function:calcium ion binding (GO:0005509)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 282 922 EGF_CA domains in 60 844 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing EGF_CA domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing EGF_CA domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the EGF_CA domain.

ProteinDescriptionDisease / phenotype
PROS_HUMANOMIM:176880 : Protein S deficiency
DLL3_HUMANOMIM:602768 : Spondylocostal dysostosis, autosomal recessive, 1
OMIM:277300 : no description
LDLR_HUMANOMIM:143890 : Hypercholesterolemia, familial
PERT_HUMANOMIM:274500 : Thyroid iodine peroxidase deficiency ; Goiter, congenital ; Hypothyroidism, congenital
LYAM2_HUMANOMIM:131210 : {Atherosclerosis, susceptibility to}
FBN2_HUMANOMIM:121050 : Contractural arachnodactyly, congenital
FA7_HUMANOMIM:227500 : Factor VII deficiency ; {Myocardial infarction, decreased susceptibility to}
FBN1_HUMANOMIM:134797 : Marfan syndrome
OMIM:154700 : Shprintzen-Goldberg syndrome
OMIM:182212 : Ectopia lentis, familial ; MASS syndrome
OMIM:604308 : no description
FBLN3_HUMANOMIM:601548 : Doyne honeycomb degeneration of retina
OMIM:126600 : no description
OMIM:126600 : Doyne honeycomb retinal dystrophy
PROC_HUMANOMIM:176860 : Thrombophilia due to protein C deficiency ; Purpura fulminans, neonatal
FA9_HUMANOMIM:306900 : Hemophilia B ; Warfarin sensitivity

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a EGF_CA domain which could be assigned to a KEGG orthologous group, and not all proteins containing EGF_CA domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamEGF
PROSITEEGF_CA
InterProIPR001881