The CHRD domain within your query sequence starts at position 400 and ends at position 517, and its E-value is 7.81e-24.

DVLQSVLCGADALIPVQTGAAGSASFILLGNGSLIYQVQVVGTGSEVVAMTLETKPQRKNQRTVLCHMAGLQPGGHMAVGMCSGLGARGAHMLLQNELFLNVGTKDFPDGELRGHVTA
CHRD

CHRD

A domain in the BMP inhibitor chordin and in microbial proteins.
SMART ACC:SM000754
Description: -
InterPro ACC:IPR010895
InterPro abstract:

CHRD (after SWISS-PROT abbreviation for chordin) is a novel domain identified in chordin, an inhibitor of bone morphogenetic proteins. This family includes bacterial homologues. It is anticipated to have an immunoglobulin-like β-barrel structure based on limited similarity to superoxide dismutases but, as yet, no clear functional prediction can be made [ PUBMED:13678956 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 860 CHRD domains in 2 060 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CHRD domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CHRD domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the CHRD domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CHRD domain which could be assigned to a KEGG orthologous group, and not all proteins containing CHRD domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

Links to other resources describing this domain

InterProIPR010895