The M60-like domain within your query sequence starts at position 543 and ends at position 842, and its E-value is 4.85e-138.

DVWMSTGLYLLEGQSTEISVSEPAASAGLKVQIGCHTDDLTFAIKLFRAPVVTYQCCMNRTQRSVSCLWGGLLYIIVPKGCQLGPVSVTITNAVPAPYYKLGKTSLEEWKSCIQKNLGPWGELATDNVILTVPTASLKTLENPEPLLQLWDEMMQAVARLASQPFPFQRPERIVADVQLSAGWMHSGYPIMCHMESVQELVSLANIRSKGLWGPIHELGHNQQCRGWEFPPHTTEATCNLWSVYVHETVLGIPRAQAHPQLKPEEREKRIKEHLQKGAPLQNWNVWTALETYLQLQEVFG
M60-like

M60-like

Peptidase M60-like family
SMART ACC:SM001276
Description:This family of peptidases contains a zinc metallopeptidase motif (HEXXHX(8,28)E) and possesses mucinase activity PMID:22299034.
InterPro ACC:IPR031161
InterPro abstract:

The peptidase family M60 domain belongs to the Merops zincin superfamily of zinc-requiring metalloproteases (clan MA, subclan MA(E)). The peptidase family M60 domain contains the metal-binding consensus motif HExxH. The two histidine residues are ligands of the catalytic Zn(2) and the glutamic acid residue is involved in nucleophilic attack. An additional conserved glutamic acid is found approximately … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 4 053 M60-like domains in 4 048 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing M60-like domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing M60-like domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a M60-like domain which could be assigned to a KEGG orthologous group, and not all proteins containing M60-like domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR031161
PfamM60-like