The PA14 domain within your query sequence starts at position 129 and ends at position 276, and its E-value is 6.07e-7.

DWCGGAVGHLRRNLHFPLFPHTRTTVTKLAVSPKWKNYGLRIFGFIHPARDGDIQFSVASDDNSEFWLSLDESPAAAQLVAFVGKTGSEWTAPGEFTKFSSQVSKPRRLMASRRYYFELLHKQDDKGSDHVEVGWRAFLPGLKFEIID
PA14

PA14

SMART ACC:SM000758
Description:domain in bacterial beta-glucosidases other glycosidases, glycosyltransferases, proteases, amidases, yeast adhesins, and bacterial toxins.
InterPro ACC:IPR011658
InterPro abstract:

The PA14 domain forms an insert in bacterial beta-glucosidases, other glycosidases, glycosyltransferases, proteases, amidases, yeast adhesins and bacterial toxins, including anthrax protective antigen (PA). The domain also occurs in a Dictyostelium pre-spore cell-inducing factor Psi and in fibrocystin, the mammalian protein whose mutation leads to polycystic kidney and hepatic disease. The crystal … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 10 451 PA14 domains in 9 320 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PA14 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PA14 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the PA14 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PA14 domain which could be assigned to a KEGG orthologous group, and not all proteins containing PA14 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamPA14
InterProIPR011658