The CYCLIN domain within your query sequence starts at position 148 and ends at position 233, and its E-value is 5.88e-26.

DWLMEVCEVYKLHRETFYLAQDFFDRYMASQHNIIKTLLQLIGISALFIASKLEEIYPPKLHQFAYVTDGACSGDEILTMELMMMK
CYCLIN

CYCLIN

domain present in cyclins, TFIIB and Retinoblastoma
SMART ACC:SM000385
Description:A helical domain present in cyclins and TFIIB (twice) and Retinoblastoma (once). A protein recognition domain functioning in cell-cycle and transcription control.
InterPro ACC:IPR013763
InterPro abstract:

This cyclin-like domain is found in cyclins, but it is also found as the core domain in transcription factor IIB (TFIIB) [ PUBMED:7675079 ] and in the retinoblastoma tumour suppressor [ PUBMED:17974914 ]. It consists of a duplication of a fold … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 61 335 CYCLIN domains in 41 443 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CYCLIN domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CYCLIN domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transcription

Relevant references for this domain

Primary literature for the CYCLIN domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the CYCLIN domain.

ProteinDescriptionDisease / phenotype
RB_HUMANOMIM:180200 : Retinoblastoma ; Osteosarcoma
OMIM:259500 : Bladder cancer
OMIM:109800 : Pinealoma with bilateral retinoblastoma

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CYCLIN domain which could be assigned to a KEGG orthologous group, and not all proteins containing CYCLIN domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfamcyclin
PROSITECYCLINS
InterProIPR013763