The UBA domain within your query sequence starts at position 276 and ends at position 313, and its E-value is 8.44e-4.

DYNIIEMLCGMGFDANEILESLQRKKYNESMGAYLILK
UBA

UBA

Ubiquitin associated domain
SMART ACC:SM000165
Description:Present in Rad23, SNF1-like kinases. The newly-found UBA in p62 is known to bind ubiquitin.
InterPro ACC:IPR015940
InterPro abstract:

UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [ PUBMED:8871400 ]. The human homologue of yeast Rad23A is one example of a nucleotide … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 32 685 UBA domains in 26 641 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing UBA domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing UBA domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Protein-binding, ubiquitin-binding

Relevant references for this domain

Primary literature for the UBA domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a UBA domain which could be assigned to a KEGG orthologous group, and not all proteins containing UBA domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamUBA
InterProIPR015940