The Cation_ATPase_N domain within your query sequence starts at position 3 and ends at position 77, and its E-value is 4.43e-12.

EAHLLSAADVLRRFSVTAEGGLSLEQVTDARERYGPNELPTEEGKSLWELVVEQFEDLLVRILLLAALVSFVLAW
Cation_ATPase_N

Cation_ATPase_N

Cation transporter/ATPase, N-terminus
SMART ACC:SM000831
Description:This entry represents the conserved N-terminal region found in several classes of cation-transporting P-type ATPases, including those that transport H+, Na+, Ca2+, Na+/K+, and H+/K+. In the H+/K+- and Na+/K+-exchange P-ATPases, this domain is found in the catalytic alpha chain. In gastric H+/K+-ATPases, this domain undergoes reversible sequential phosphorylation inducing conformational changes that may be important for regulating the function of these ATPases (PUBMED:12480547), (PUBMED:12529322).
InterPro ACC:IPR004014
InterPro abstract:

This entry represents the conserved N-terminal region found in several classes of cation-transporting P-type ATPases, including those that transport H + ( EC:7.1.2.1 ), Na + ( EC:7.2.2.3 ), Ca 2+ ( EC:7.2.2.10 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 45 454 Cation_ATPase_N domains in 45 418 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Cation_ATPase_N domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Cation_ATPase_N domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:
Binding / catalysis:Membrane-bound

Relevant references for this domain

Primary literature for the Cation_ATPase_N domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Cation_ATPase_N domain which could be assigned to a KEGG orthologous group, and not all proteins containing Cation_ATPase_N domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR004014
PfamCation_ATPase_N