The EGF_like domain within your query sequence starts at position 837 and ends at position 868, and its E-value is 6.28e1.

ECHHTCRTCVGPSREECIHCAKSFHFQDWKCV
EGF_like

EGF_like

EGF domain, unclasssified subfamily
SMART ACC:SM000001
Description: -
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 116 150 EGF_like domains in 57 116 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing EGF_like domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing EGF_like domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a EGF_like domain which could be assigned to a KEGG orthologous group, and not all proteins containing EGF_like domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain