The GGL domain within your query sequence starts at position 255 and ends at position 316, and its E-value is 2.75e-27.

EDELHQQIKYWQIQLDRHRLKMSKVADSLLSYTEQYVEYDPFLVPPDPSNPWLSDDTTFWEL
GGL

GGL

G protein gamma subunit-like motifs
SMART ACC:SM000224
Description: -
InterPro ACC:IPR015898
InterPro abstract:

This entry represents the G protein gamma subunit and the GGL (G protein gamma-like) domain, which are related in sequence and are comprised of an extended α-helical polypeptide. The G protein gamma subunit forms a stable dimer with the beta subunit, but it does not make any contact with the alpha subunit, which contacts the opposite face of the beta subunit. The GGL domain is found in several … expand

GO process:G protein-coupled receptor signaling pathway (GO:0007186)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 4 851 GGL domains in 4 845 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing GGL domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing GGL domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling

Relevant references for this domain

Primary literature for the GGL domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a GGL domain which could be assigned to a KEGG orthologous group, and not all proteins containing GGL domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamG_protein_gamma
InterProIPR015898
PROSITEG_PROTEIN_GAMMA