The SPEC domain within your query sequence starts at position 3319 and ends at position 3423, and its E-value is 3.01e-8.

EDFYRKLKALNDAATAAEEGEALQWIVGTEVDVINQQLADFKLFQKDQVDPLQVKLQQVNGLGQGLIQSAGKNCDVQGLEHDMDEINTRWNTLNKKVAQRIAQLQ
SPEC

SPEC

Spectrin repeats
SMART ACC:SM000150
Description: -
InterPro ACC:IPR018159
InterPro abstract:

Spectrin repeats are found in several proteins involved in cytoskeletal structure and in proteins with a more regulatory role mostly in animals [ PUBMED:8266097 PUBMED:11911890 ]. This entry includes spectrin alpha and beta subunits, alpha-actinin … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 257 395 SPEC domains in 23 741 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing SPEC domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing SPEC domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the SPEC domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the SPEC domain.

ProteinDescriptionDisease / phenotype
SPTB1_HUMANOMIM:182870 : Elliptocytosis-3 ; Spherocytosis-1 ; Anemia, neonatal hemolytic, fatal and near-fatal
SPTA1_HUMANOMIM:182860 : Elliptocytosis-2 ; Pyropoikilocytosis ; Spherocytosis, recessive

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a SPEC domain which could be assigned to a KEGG orthologous group, and not all proteins containing SPEC domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfamspectrin
InterProIPR018159