The LA domain within your query sequence starts at position 156 and ends at position 234, and its E-value is 3.25e-36.

EDPREVLKKTLEFCLSRENLASDMYLISQMDSDQYVPITTVANLDHIKKLSTDVDLIVEVLRSLPLVQVDEKGEKVRPN
LA

LA

Domain in the RNA-binding Lupus La protein; unknown function
SMART ACC:SM000715
Description: -
InterPro ACC:IPR006630
InterPro abstract:

This domain is found at the N terminus of La RNA-binding proteins as well as other proteins [ PUBMED:8035818 ].

Human Ro ribonucleoproteins (RNPs) are composed of one of the four small Y RNAs and at least two proteins, Ro60 and La. The La protein is a 47kDa polypeptide that frequently acts as an autoantigen … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 7 892 LA domains in 7 878 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing LA domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing LA domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Translation

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a LA domain which could be assigned to a KEGG orthologous group, and not all proteins containing LA domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006630