The DISIN domain within your query sequence starts at position 398 and ends at position 474, and its E-value is 1.21e-27.

EEDEICDCGKKGCAEMPPPCCNPDTCKLSDGSECSSGICCNSCKLKRKGEVCRLAQDECDVTEYCNGTSEVCEDFFV
DISIN

DISIN

Homologues of snake disintegrins
SMART ACC:SM000050
Description:Snake disintegrins inhibit the binding of ligands to integrin receptors. They contain a 'RGD' sequence, identical to the recognition site of many adhesion proteins. Molecules containing both disintegrin and metalloprotease domains are known as ADAMs.
InterPro ACC:IPR001762
InterPro abstract:

Disintegrins are a family of small proteins from viper venoms that function as potent inhibitors of both platelet aggregation and integrin-dependent cell adhesion [ PUBMED:15578957 PUBMED:15974889 ]. Integrin receptors are involved in cell-cell … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 12 250 DISIN domains in 12 145 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DISIN domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DISIN domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the DISIN domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DISIN domain which could be assigned to a KEGG orthologous group, and not all proteins containing DISIN domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001762
PROSITEDISIN_DOMAIN
Pfamdisintegrin