The DYNc domain within your query sequence starts at position 12 and ends at position 255, and its E-value is 3.52e-134.

EEKVRPCIDLIDTLRALGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLRKLKEGEEWRGKVSYDDIEVELSDPSEVEEAINKGQNFIAGVGLGISDKLISLDVSSPNVPDLTLIDLPGITRVAVGNQPADIGRQIKRLIKTYIQKQETINLVVVPSNVDIATTEALSMAQEVDPEGDRTIGVLTKPDLVDRGAEGKVLDVMRNLVYPLKKGYMIVKCRGQQDIQEQ
DYNc

DYNc

Dynamin, GTPase
SMART ACC:SM000053
Description:Large GTPases that mediate vesicle trafficking. Dynamin participates in the endocytic uptake of receptors, associated ligands, and plasma membrane following an exocytic event.
InterPro ACC:IPR001401
InterPro abstract:

Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another. Dynamins are large GTPases that belong to a protein superfamily [ PUBMED:15040446 ] that, in eukaryotic cells, includes … expand

GO function:GTP binding (GO:0005525), GTPase activity (GO:0003924)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 11 766 DYNc domains in 11 740 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DYNc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DYNc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:GTP-hydrolysis

Relevant references for this domain

Primary literature for the DYNc domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DYNc domain which could be assigned to a KEGG orthologous group, and not all proteins containing DYNc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001401
Pfamdynamin