The EPH_lbd domain within your query sequence starts at position 34 and ends at position 227, and its E-value is 2.18e-100.

EEVLLDTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTRTFEACHVAGLPPGSGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVSGGTCRETFTLYYRQADEPDGPDSIAAWHLKRWTKVDTIAADESFPASSSSSSWAVGPHRTGQRVGLQLNVKERSFGPLTQRGFYVAFQDTGACLALVAVKLFSYTC
EPH_lbd

EPH_lbd

Ephrin receptor ligand binding domain
SMART ACC:SM000615
Description: -
InterPro ACC:IPR001090
InterPro abstract:

The Eph receptors, which bind a group of cell-membrane-anchored ligands known as ephrins, represent the largest subfamily of receptor tyrosine kinases (RTKs). The Eph receptors and their ephrin ligands control a diverse array of cell-cell interactions in the nervous and vascular systems. On ephrin binding, the Eph kinase domain is activated, initiating 'forward' signaling in the receptor-expressing … expand

GO function:protein binding (GO:0005515)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 5 603 EPH_lbd domains in 5 601 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing EPH_lbd domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing EPH_lbd domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a EPH_lbd domain which could be assigned to a KEGG orthologous group, and not all proteins containing EPH_lbd domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamEPH_lbd
InterProIPR001090