The Sm domain within your query sequence starts at position 8 and ends at position 76, and its E-value is 1.3e-10.

EFSLTYTQDTVLAARRYEILTGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGE
Sm

Sm

snRNP Sm proteins
SMART ACC:SM000651
Description:small nuclear ribonucleoprotein particles (snRNPs) involved in pre-mRNA splicing
InterPro ACC:IPR001163
InterPro abstract:

This domain is found in Lsm (like-Sm) proteins, which have a core structure consisting of an open β-barrel with an SH3-like topology.

Lsm (like-Sm) proteins have diverse functions, and are thought to be important modulators of RNA biogenesis and function [ PUBMED:10801455 PUBMED:12438310 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 20 551 Sm domains in 20 519 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Sm domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Sm domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Protein binding

Relevant references for this domain

Primary literature for the Sm domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Sm domain which could be assigned to a KEGG orthologous group, and not all proteins containing Sm domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001163
PfamSm