The PAS domain within your query sequence starts at position 84 and ends at position 150, and its E-value is 4.28e-10.

EFTQLMLEALDGFVIVVTTDGSIIYVSDSITPLLGHLPADVMDQNLLNFLPEQEHSEVYKILSSHML
PAS

PAS

PAS domain
SMART ACC:SM000091
Description:PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels ([1]; Ponting & Aravind, in press).
InterPro ACC:IPR000014
InterPro abstract:

PAS domains are involved in many signalling proteins where they are used as a signal sensor domain [ PUBMED:10357859 ]. PAS domains appear in archaea, bacteria and eukaryotes. Several PAS-domain proteins are known to detect their signal by way of an associated cofactor. Heme,flavin, and a 4-hydroxycinnamyl chromophore … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 613 402 PAS domains in 396 128 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PAS domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PAS domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the PAS domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PAS domain which could be assigned to a KEGG orthologous group, and not all proteins containing PAS domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000014