The DMAP_binding domain within your query sequence starts at position 7 and ends at position 120, and its E-value is 3.55e-43.

EGMALPLEVRARLAELELELSEGDITQKGYEKKRSKLIGAYLPQPPRVDQALPQERRAPVTPSSASRYHRRRSSGSRDERYRSDVHTEAVQAALAKHKERKMAVPMPSKRRSLV
DMAP_binding

DMAP_binding

DMAP1-binding Domain
SMART ACC:SM001137
Description:This domain binds DMAP1, a transcriptional co-repressor.
InterPro ACC:IPR010506
InterPro abstract:

This is a ~120-amino acid protein-protein interaction module that binds DMAP1 (DNA methyltransferase-associated protein 1), a transcriptional co-repressor. It is found at the N terminus of DNMT1 (DNA methyltransferase 1) [ PUBMED:10888872 ] and animal disco-interacting protein 2 (DIP-2), a protein that maintains morphology … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 493 DMAP_binding domains in 2 490 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DMAP_binding domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DMAP_binding domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transcription
Binding / catalysis:Binds DMAP1, a transcriptional co-repressor.

Relevant references for this domain

Primary literature for the DMAP_binding domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DMAP_binding domain which could be assigned to a KEGG orthologous group, and not all proteins containing DMAP_binding domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamDMAP_binding
InterProIPR010506