The DUF4205 domain within your query sequence starts at position 3 and ends at position 160, and its E-value is 3.65e-19.

EGSALEQFEGGPCAVIAPVQAFLLKKLLFSSEKSSWRDCSAALAVEELGFERFHALIQKRSFRTVSELKDAVLDQYSMWGNKFGVLLFLYSVLLTKGIENIKNSIEDANEPLIDPVYGHGSQSLINLLLTGHAVSNVWDGDRECSGMQLLGIHEQAAV
DUF4205

DUF4205

SMART ACC:SM001174
Description:The proteins in this family are uncharacterized but often named FAM188B.
InterPro ACC:IPR025257
InterPro abstract:

This is a conserved domain found in deubiquitinating enzymes, MINDY-3 and MINDY-4.

Deubiquitinating enzymes (DUBs) remove ubiquitin (Ub) from Ub-conjugated substrates to regulate the functional outcome of ubiquitylation. This entry includes MINDY-3/4. They belong to the MINDY (motif interacting with Ub-containing novel DUB) family (peptidase family C121), whose members are deubiquitinating … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 902 DUF4205 domains in 1 902 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DUF4205 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DUF4205 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DUF4205 domain which could be assigned to a KEGG orthologous group, and not all proteins containing DUF4205 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

Links to other resources describing this domain

PfamDUF4205
InterProIPR025257