The SH2 domain within your query sequence starts at position 633 and ends at position 712, and its E-value is 3.93e-2.

EHNWWEGRNTATNEVGWFPCNRVHPYVHGPPQDLSVHLWYNVEVKHIKIMTSEGLYRITEKKAFRGLLELVEFYQQNSLK
SH2

SH2

Src homology 2 domains
SMART ACC:SM000252
Description:Src homology 2 domains bind phosphotyrosine-containing polypeptides via 2 surface pockets. Specificity is provided via interaction with residues that are distinct from the phosphotyrosine. Only a single occurrence of a SH2 domain has been found in S. cerevisiae.
InterPro ACC:IPR000980
InterPro abstract:

The Src homology 2 (SH2) domain is a protein domain of about 100 amino-acid residues first identified as a conserved sequence region between the oncoproteins Src and Fps [ PUBMED:3025655 ]. Similar sequences were later found in many other intracellular signal-transducing proteins [ PUBMED:1377638 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 58 927 SH2 domains in 53 279 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing SH2 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing SH2 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling
Binding / catalysis:Phosphotyrosine-containing peptide-binding

Relevant references for this domain

Primary literature for the SH2 domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the SH2 domain.

ProteinDescriptionDisease / phenotype
SH21A_HUMANOMIM:308240 : Lymphoproliferative syndrome, X-linked
BTK_HUMANOMIM:300300 : Agammaglobulinemia, type 1, X-linked ; ?XLA and isolated growth hormone deficiency
OMIM:307200 : no description
RASA1_HUMANOMIM:139150 : Basal cell carcinoma

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a SH2 domain which could be assigned to a KEGG orthologous group, and not all proteins containing SH2 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamSH2
PROSITESH2
InterProIPR000980