The LysM domain within your query sequence starts at position 72 and ends at position 116, and its E-value is 1.91e-10.

EHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLSIP
LysM

LysM

Lysin motif
SMART ACC:SM000257
Description: -
InterPro ACC:IPR018392
InterPro abstract:

The LysM (lysin motif) domain is a small globular domain, approximately 40 amino acids long. It is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls [ PUBMED:1352512 ], but proteins involved … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 136 958 LysM domains in 89 509 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing LysM domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing LysM domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a LysM domain which could be assigned to a KEGG orthologous group, and not all proteins containing LysM domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR018392