The PAW domain within your query sequence starts at position 484 and ends at position 576, and its E-value is 1.05e-29.

EKISKQFHLRYDIVRDRYIRVSDNNINISGWENGVWKMESIFRKVEKDWNMVYLARKEGSSFAYISWKFECGSAGLKVDTVSIRTSSQSFESG
PAW

PAW

domain present in PNGases and other hypothetical proteins
SMART ACC:SM000613
Description:present in several copies in proteins with unknown function in C. elegans
InterPro ACC:IPR006588
InterPro abstract:

The PAW domain (present in PNGases and other worm proteins) is found as a single copy at the C terminus of metazoan peptide:N-glycanase (PNGase) and in multiple copies in hypothetical Caenorhabditis elegans proteins peptide:N-glycanases (PNGases) [ PUBMED:11779830 ]. The C-terminal PAW domain of PNGase binds to the mannose … expand

GO process:glycoprotein catabolic process (GO:0006516)
GO component:cytoplasm (GO:0005737)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 549 PAW domains in 530 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PAW domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PAW domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the PAW domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PAW domain which could be assigned to a KEGG orthologous group, and not all proteins containing PAW domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006588