The ZnF_DBF domain within your query sequence starts at position 287 and ends at position 334, and its E-value is 7.09e-28.

EKRKKGYCECCLQKYEDLETHLLSEKHRNFAQSNQYQVVDDIVSQLVF
ZnF_DBF

ZnF_DBF

Zinc finger in DBF-like proteins
SMART ACC:SM000586
Description: -
InterPro ACC:IPR006572
InterPro abstract:

Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a … expand

GO function:zinc ion binding (GO:0008270), nucleic acid binding (GO:0003676)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 512 ZnF_DBF domains in 1 512 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ZnF_DBF domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ZnF_DBF domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the ZnF_DBF domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ZnF_DBF domain which could be assigned to a KEGG orthologous group, and not all proteins containing ZnF_DBF domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006572