The HOLI domain within your query sequence starts at position 61 and ends at position 221, and its E-value is 5.16e-47.

ELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVS
HOLI

HOLI

Ligand binding domain of hormone receptors
SMART ACC:SM000430
Description: -
InterPro ACC:IPR000536
InterPro abstract:

Nuclear receptors (NRs), such as the receptors for steroids and thyroid hormones, retinoids and vitamin D3, are one of the most abundant classes of transcriptional regulators in animals (metazoans). They regulate diverse functions, such as homeostasis, reproduction, development and metabolism. The most prominent feature differentiating them from other transcription factors is their capacity to … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 28 310 HOLI domains in 28 124 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing HOLI domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing HOLI domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Hormones

Relevant references for this domain

Primary literature for the HOLI domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the HOLI domain.

ProteinDescriptionDisease / phenotype
HNF4A_HUMANOMIM:600281 : MODY, type 1
OMIM:125850 : {Diabetes mellitus, noninsulin-dependent}
OMIM:125853 : no description
ANDR_HUMANOMIM:313700 : Androgen insensitivity, several forms ; Spinal and bulbar muscular atrophy of Kennedy
OMIM:313200 : Prostate cancer ; Perineal hypospadias ; Breast cancer, male, with Reifenstein syndrome
GCR_HUMANOMIM:138040 : Cortisol resistance
VDR_HUMANOMIM:601769 : Rickets, vitamin D-resistant
OMIM:277440 : ?Osteoporosis, involutional
NR2E3_HUMANOMIM:604485 : Enhanced S-cone syndrome
OMIM:268100 : Retinitis pigmentosa, late onset
OMIM:268000 : no description
ESR1_HUMANOMIM:133430 : Breast cancer ; Estrogen resistance
NR0B1_HUMANOMIM:300200 : Adrenal hypoplasia, congenital, with hypogonadotropic hypogonadism ; Dosage-sensitive sex reversal
OMIM:300018 : no description
THB_HUMANOMIM:190160 : Thyroid hormone resistance
OMIM:274300 : no description
OMIM:188570 : no description
PPARG_HUMANOMIM:601487 : Obesity, severe
OMIM:601665 : [Obesity, protection against] ; Diabetes mellitus, insulin-resistant, with acanthosis nigricans and hypertension
OMIM:604367 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a HOLI domain which could be assigned to a KEGG orthologous group, and not all proteins containing HOLI domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfamhormone_rec
InterProIPR000536