The PLDc domain within your query sequence starts at position 665 and ends at position 715, and its E-value is 2.5e1.

All catalytic sites are present in this domain, and marked green in the sequence below. Check the literature (PubMed 10074947 ) for details.

ELIYVHSKLLIADDNTVIIATPWFVTIISWLSQESPSFVLKHGSANINDRS
PLDc

PLDc

Phospholipase D. Active site motifs.
SMART ACC:SM000155
Description:Phosphatidylcholine-hydrolyzing phospholipase D (PLD) isoforms are activated by ADP-ribosylation factors (ARFs). PLD produces phosphatidic acid from phosphatidylcholine, which may be essential for the formation of certain types of transport vesicles or may be constitutive vesicular transport to signal transduction pathways. PC-hydrolysing PLD is a homologue of cardiolipin synthase, phosphatidylserine synthase, bacterial PLDs, and viral proteins. Each of these appears to possess a domain duplication which is apparent by the presence of two motifs containing well-conserved histidine, lysine, aspartic acid, and/or asparagine residues which may contribute to the active site. An E. coli endonuclease (nuc) and similar proteins appear to be PLD homologues but possess only one of these motifs. The profile contained here represents only the putative active site regions, since an accurate multiple alignment of the repeat units has not been achieved.
InterPro ACC:IPR001736
InterPro abstract:

Phosphatidylcholine-hydrolysing phospholipase D (PLD) isoforms are activated by ADP-ribosylation factors (ARFs). PLD produces phosphatidic acid from phosphatidylcholine, which may be essential for the formation of certain types of transport vesicles or may be constitutive vesicular transport to signal transduction pathways. PC-hydrolysing PLD is a homologue of cardiolipin synthase, phosphatidylserine … expand

GO function:catalytic activity (GO:0003824)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 86 578 PLDc domains in 45 058 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PLDc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PLDc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Phospholipase d, choline phosphatase, nuclease

Relevant references for this domain

Primary literature for the PLDc domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PLDc domain which could be assigned to a KEGG orthologous group, and not all proteins containing PLDc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001736