The MGS domain within your query sequence starts at position 1264 and ends at position 1365, and its E-value is 1.35e-7.

ELLPTVRLLESLGYSLYASLGTADFYTEHGVKVTAVDWHFEEAVDGECPPQRSILDQLAENHFELVINLSMRGAGGRRLSSFVTKGYRTRRLAADFSVPLII
MGS

MGS

MGS-like domain
SMART ACC:SM000851
Description:This domain composes the whole protein of methylglyoxal synthetase and the domain is also found in Carbamoyl phosphate synthetase (CPS) where it forms a regulatory domain that binds to the allosteric effector ornithine. This family also includes inosicase. The known structures in this family show a common phosphate binding site (PUBMED:10526357).
InterPro ACC:IPR011607
InterPro abstract:

Methylglyoxal synthase (MGS, EC:4.2.3.3 ), which catalyses the conversion of dihydroxyacetone phosphate (DHAP) to methylglyoxal (MG) and inorganic phosphate, has been found in many organisms, including enteric bacteria, some gram-positive bacteria, a number of archaebacteria, several yeast species and goat liver [ expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 47 239 MGS domains in 47 236 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing MGS domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing MGS domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Interaction (with the environment)

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a MGS domain which could be assigned to a KEGG orthologous group, and not all proteins containing MGS domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR011607
PfamMGS