The Zalpha domain within your query sequence starts at position 134 and ends at position 203, and its E-value is 8.97e-30.

ELSISQSPEQKVLNRLEELGEGKATTAHVLARELRIPKRDINRILYSLEKKGKLHRGRGKPPLWSLVPLS
Zalpha

Zalpha

Z-DNA-binding domain in adenosine deaminases.
SMART ACC:SM000550
Description:Helix-turn-helix-containing domain. Also known as Zab.
InterPro ACC:IPR042371
InterPro abstract:

Double-stranded (ds) DNA typically adopts the so-called B-conformation, while dsRNA is usually in the A-conformation. Both DNA and RNA can also adopt a Z-form double helix that is characterised by a left-handed helical arrangement, a zigzag pattern of the phosphodiester backbone and the absence of major grooves. Z-DNA is believed to play a role in transcription by relieving torsional strain induced … expand

GO function:RNA binding (GO:0003723), double-stranded RNA adenosine deaminase activity (GO:0003726)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 934 Zalpha domains in 478 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Zalpha domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Zalpha domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the Zalpha domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Zalpha domain which could be assigned to a KEGG orthologous group, and not all proteins containing Zalpha domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR042371