The A1pp domain within your query sequence starts at position 85 and ends at position 221, and its E-value is 6.75e-33.

ELSVWKDDLTRHVVDAVVNAANENLLHGSGLAGSLVKTGGFEIQEESKRIIANVGKISVGGIAITGAGRLPCHLIIHAVGPRWTVTNSQTAIELLKFAIRNILDYVTKYDLRIKTVAIPALSSGIFQFPLDLCTSII
A1pp

A1pp

Appr-1"-p processing enzyme
SMART ACC:SM000506
Description:Function determined by Martzen et al. Extended family detected by reciprocal PSI-BLAST searches (unpublished results, and Pehrson & Fuji).
InterPro ACC:IPR002589
InterPro abstract:

The Macro or A1pp domain is a module of about 180 amino acids which can bind ADP-ribose (an NAD metabolite) or related ligands. Binding to ADP-ribose could be either covalent or non-covalent [ PUBMED:16959969 ]: in certain cases it is believed to bind non-covalently [ PUBMED:18983849 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 16 662 A1pp domains in 14 754 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing A1pp domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing A1pp domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the A1pp domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a A1pp domain which could be assigned to a KEGG orthologous group, and not all proteins containing A1pp domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR002589