The DSPc domain within your query sequence starts at position 28 and ends at position 173, and its E-value is 2.71e-64.

Some of the required catalytic sites were not detected in this domain, and are marked red in the sequence below. The domain is probably inactive. Check the literature (PubMed 96243129 ) for details.

Catalytic residues
Position
DomainProteinAmino acidPresent?
6289DYes
93120CNo
100127SYes
EMQEVLPGLFLGPYSSAMKSKLPILQKHGITHIICIRQNIEANFIKPNFQQLFRYLVLDIADNPVENIIRFFPMTKEFIDGSLQNGGKVLVHGNAGISRSAAFVIAYIMETFGMKYRDAFAYVQERRFCINPNAGFVHQLQLWLSW
DSPc

DSPc

Dual specificity phosphatase, catalytic domain
SMART ACC:SM000195
Description: -
InterPro ACC:IPR020422
InterPro abstract:

Tyrosine specific protein phosphatases (PTPases) ( EC:3.1.3.48 ) contain two conserved cysteines, the second one has been shown to be absolutely required for activity. This entry represents the PTPase domain that centre on the active site cysteine. A number of conserved residues in its immediate vicinity have also been shown … expand

GO process:protein dephosphorylation (GO:0006470)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 17 170 DSPc domains in 17 099 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DSPc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DSPc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling
Binding / catalysis:Protein tyrosine phosphatase

Relevant references for this domain

Primary literature for the DSPc domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DSPc domain which could be assigned to a KEGG orthologous group, and not all proteins containing DSPc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITETYR_PHOSPHATASE_DUAL
InterProIPR020422
PfamDSPc