The Aha1_N domain within your query sequence starts at position 2 and ends at position 115, and its E-value is 2.33e-38.

ENEAGRCEISELKQVEGEASCNSRKGKLIFFYEWNIKLAWKGTVKESGAKHKGLIEIPSLSEENEINDTEVNVSKKKGDGEILKDLMRTTGTAKVREALGEYLKALKTEFTTGM
Aha1_N

Aha1_N

Activator of Hsp90 ATPase, N-terminal
SMART ACC:SM001000
Description:This domain is predominantly found in the protein 'Activator of Hsp90 ATPase', it adopts a secondary structure consisting of an N-terminal alpha-helix leading into a four-stranded meandering antiparallel beta-sheet, followed by a C-terminal alpha-helix. The two helices are packed together, with the beta-sheet curving around them. They bind to the molecular chaperone HSP82 and stimulate its ATPase activity (PUBMED:15039704).
InterPro ACC:IPR015310
InterPro abstract:

This entry includes a group of heat shock protein interacting proteins, including AHSA1/2 from animals and Aha1/Hch1 from budding yeasts, and it represents a domain found at the N-terminal of Aha1 and AHSA1/2, while in Hch1 is the only domain. Aha1 adopts a secondary structure consisting of an N-terminal α-helix leading into a four-stranded meandering antiparallel β-sheet, followed by a C-terminal … expand

GO function:ATPase activator activity (GO:0001671), protein-folding chaperone binding (GO:0051087)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 381 Aha1_N domains in 2 334 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Aha1_N domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Aha1_N domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Interaction (with the environment)

Relevant references for this domain

Primary literature for the Aha1_N domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Aha1_N domain which could be assigned to a KEGG orthologous group, and not all proteins containing Aha1_N domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamAha1_N
InterProIPR015310