The CLb domain within your query sequence starts at position 22 and ends at position 225, and its E-value is 2.18e-148.

EQEVSDNELQELSTQGSRYINKEIQNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVCNETMMALWEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFARASGIIDTLFQDRFFARELHDPHYFSPIGFPHKRPHFLYPKSRLV
CLb

CLb

CLUSTERIN Beta chain
SMART ACC:SM000030
Description: -
InterPro ACC:IPR016014
InterPro abstract:

Clusterin is a vertebrate glycoprotein [ PUBMED:1585460 ], the exact function of which is not yet clear. Clusterin expression is complex, appearing as different forms in different cell compartments. One set of proteins is directed for secretion, and other clusterin species are expressed in the cytoplasm and nucleus. The … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 637 CLb domains in 636 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CLb domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CLb domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CLb domain which could be assigned to a KEGG orthologous group, and not all proteins containing CLb domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR016014