The ANK domain within your query sequence starts at position 383 and ends at position 412, and its E-value is 1.04e2.

EQLTPAGLAIKNGQLECVRWMVSETEAIAE
ANK

ANK

ankyrin repeats
SMART ACC:SM000248
Description:Ankyrin repeats are about 33 amino acids long and occur in at least four consecutive copies. They are involved in protein-protein interactions. The core of the repeat seems to be an helix-loop-helix structure.
InterPro ACC:IPR002110
InterPro abstract:

The ankyrin repeat is one of the most common protein-protein interaction motifs in nature. Ankyrin repeats are tandemly repeated modules of about 33 amino acids. They occur in a large number of functionally diverse proteins mainly from eukaryotes. The few known examples from prokaryotes and viruses may be the result of horizontal gene transfers. The repeat has been found in proteins of diverse … expand

GO function:protein binding (GO:0005515)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 471 345 ANK domains in 265 757 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ANK domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ANK domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the ANK domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the ANK domain.

ProteinDescriptionDisease / phenotype
ANK1_HUMANOMIM:182900 : Spherocytosis-2
RFXK_HUMANOMIM:603200 : MHC class II deficiency, complementation group B
OMIM:209920 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ANK domain which could be assigned to a KEGG orthologous group, and not all proteins containing ANK domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR002110
Pfamank