The SOCS domain within your query sequence starts at position 219 and ends at position 264, and its E-value is 7.93e-13.

ERRVEEPQSLLHLSRLCVRHALGDTRLGQISTLPLPPAMKRYLLYK
SOCS

SOCS

suppressors of cytokine signalling
SMART ACC:SM000253
Description:suppressors of cytokine signalling
InterPro ACC:IPR001496
InterPro abstract:

The SOCS box was first identified in SH2-domain-containing proteins of the suppressor of cytokines signalling (SOCS) family [ PUBMED:9202125 ] but was later also found in:

  • the WSB (WD-40-repeat-containing proteins with a SOCS box) family,
  • the SSB (SPRY domain-containing proteins with a SOCS box) … expand
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 381 SOCS domains in 3 379 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing SOCS domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing SOCS domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the SOCS domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a SOCS domain which could be assigned to a KEGG orthologous group, and not all proteins containing SOCS domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001496