The TR_THY domain within your query sequence starts at position 27 and ends at position 147, and its E-value is 5.95e-91.

ESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN
TR_THY

TR_THY

Transthyretin
SMART ACC:SM000095
Description: -
InterPro ACC:IPR023416
InterPro abstract:

This family includes transthyretin that is a thyroid hormone-binding protein that transports thyroxine from the bloodstream to the brain. However, most of the sequences listed in this family do not bind thyroid hormones. They are actually enzymes of the purine catabolism that catalyse the conversion of 5-hydroxyisourate (HIU) to OHCU [ PUBMED:16098976 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 116 TR_THY domains in 3 113 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing TR_THY domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing TR_THY domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the TR_THY domain.

ProteinDescriptionDisease / phenotype
TTHY_HUMANOMIM:176300 : Amyloid neuropathy, familial, several allelic types ; [Dystransthyretinemic hyperthyroxinemia]; Amyloidosis, senile systemic ; Carpal tunnel syndrome, familial

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a TR_THY domain which could be assigned to a KEGG orthologous group, and not all proteins containing TR_THY domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEPS00769
InterProIPR023416